PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0194s00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family TCP
Protein Properties Length: 422aa    MW: 45730.8 Da    PI: 10.5606
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0194s00140.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP56.79.8e-18191229240
                TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLG 40 
                        + k+ +++++hTkv+gR+RR+R++a+caar+F+L++eL 
  Vradi0194s00140.1 191 PQKRASTKDRHTKVEGRGRRIRMPATCAARIFQLTRELD 229
                        57999********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.6E-13196228IPR005333Transcription factor, TCP
PROSITE profilePS513699.294197228IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MNEPSKNNKL RCCGLLCVDE GEYGYERETD WISEENGLEL VSVSDFFNWD HRDDRKKVEK  60
EEAWVLVNTQ IGTREGPIIR SERGAGATKP GRAMGLFASG WWAPCGGRGT IQLGDGGSHW  120
GQSRCRGSGQ RRDSDFQDKV CGLWAHLLMG PKVEPETEEA SAIRVMPVAV HVPSGMSMSV  180
SKALAQAQAQ PQKRASTKDR HTKVEGRGRR IRMPATCAAR IFQLTRELDP PERKKRKRPA  240
NSAYVDVNDG AVSVPAGLAS SNKQSSRTIT TTASTTTTIP QHTAIPLPQG VVPVWAVPSN  300
AVVPTAGAFF VVPQAASFQH HPQFFTIARP ISAFVSSMVT PVQLQPTSTS SSANANPSST  360
APSSKSPARA TRWDPKGRIV RVMGGPYGTV YAPFSSRPFQ SGPSVARKSR RLRVALCLVD  420
R*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1231238ERKKRKRP
2232237RKKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014522942.11e-115PREDICTED: transcription factor TCP9
TrEMBLA0A0L9VRK81e-112A0A0L9VRK8_PHAAN; Uncharacterized protein
STRINGGLYMA03G02090.16e-96(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.12e-30TCP family protein